SCOP 1.67: Domain d1kxra_: 1kxr A:

Lineage for d1kxra_ (1kxr A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (10 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (3 species)
   includes the N-terminal 'sequence' domain I

7. Species Rat (Rattus norvegicus), mu-type [TaxId:10116] [75332] (2 PDB entries)

8. Domain d1kxra_: 1kxr A: [73175]

Details for d1kxra_

PDB Entry: 1kxr, 2.07 Å

PDB Description: crystal structure of calcium-bound protease core of calpain i

SCOP Domain Sequences for d1kxra_:

Sequence; same for both SEQRES and ATOM records:

>d1kxra_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type}
naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdswllaaiasltlnetilhrvvpygqsfqegyagifhfq
lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
efwmsfrdfireftkleicn

Timeline for d1kxra_:

• d1kxra_ first appeared in SCOP 1.61
  
• d1kxra_ appears in SCOP 1.65
  
• d1kxra_ appears in SCOP 1.69
  
• d1kxra_ appears in the current release, SCOPe 2.08