SCOP 1.75: Domain d1kxqa2: 1kxq A:1-403

Lineage for d1kxqa2 (1kxq A:1-403)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Animal alpha-amylase [51458] (3 species)
   contains Ca2+-binding subdomain, residues 100-170

7. Species Pig (Sus scrofa) [TaxId:9823] [51459] (14 PDB entries)

8. Domain d1kxqa2: 1kxq A:1-403 [73164]
   Other proteins in same PDB: d1kxqa1, d1kxqb1, d1kxqc1, d1kxqd1, d1kxqe_, d1kxqf_, d1kxqg_, d1kxqh_

Details for d1kxqa2

PDB Entry: 1kxq, 1.6 Å

PDB Description: camelid vhh domain in complex with porcine pancreatic alpha-amylase

PDB Compounds: (A:) alpha-amylase, pancreatic

SCOP Domain Sequences for d1kxqa2:

Sequence; same for both SEQRES and ATOM records:

>d1kxqa2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg

Timeline for d1kxqa2:

• d1kxqa2 first appeared in SCOP 1.61
  
• d1kxqa2 appears in SCOP 1.73
  
• d1kxqa2 appears in SCOPe 2.01
  
• d1kxqa2 appears in the current release, SCOPe 2.08