Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin [53073] (6 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (10 PDB entries) |
Domain d1kxpa2: 1kxp A:147-364 [73159] Other proteins in same PDB: d1kxpd1, d1kxpd2, d1kxpd3 complexed with atp, mg |
PDB Entry: 1kxp (more details), 2.1 Å
SCOP Domain Sequences for d1kxpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxpa2 c.55.1.1 (A:147-364) Actin {Rabbit (Oryctolagus cuniculus)} rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwitkqeyde
Timeline for d1kxpa2: