Lineage for d1kxma_ (1kxm A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1496991Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1497010Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 1497011Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
    Uniprot P00431
  8. 1497088Domain d1kxma_: 1kxm A: [73156]
    proposed electron transfer pathway excised to form a ligand binding channel
    complexed with bzi, hem

Details for d1kxma_

PDB Entry: 1kxm (more details), 1.74 Å

PDB Description: crystal structure of cytochrome c peroxidase with a proposed electron transfer pathway excised to form a ligand binding channel.
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1kxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxma_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpky
lsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d1kxma_:

Click to download the PDB-style file with coordinates for d1kxma_.
(The format of our PDB-style files is described here.)

Timeline for d1kxma_: