SCOPe 2.08: Domain d1kxha1: 1kxh A:355-448

Lineage for d1kxha1 (1kxh A:355-448)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Pseudoalteromonas haloplanktis [TaxId:228] [51015] (9 PDB entries)

8. Domain d1kxha1: 1kxh A:355-448 [73151]
   Other proteins in same PDB: d1kxha2
   complexed with ca, cl; mutant

Details for d1kxha1

PDB Entry: 1kxh, 2.3 Å

PDB Description: crystal structure of the complex between an inactive mutant of psychrophilic alpha-amylase (d174n) and acarbose

PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1kxha1:

Sequence; same for both SEQRES and ATOM records:

>d1kxha1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanktis [TaxId: 228]}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln

Timeline for d1kxha1:

• d1kxha1 first appeared in SCOP 1.61
  
• d1kxha1 appears in SCOPe 2.07