Lineage for d1kvlb_ (1kvl B:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883343Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)
  6. 883349Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 883369Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (46 PDB entries)
  8. 883385Domain d1kvlb_: 1kvl B: [73063]
    complexed with cls, kcp, po4, thn; mutant

Details for d1kvlb_

PDB Entry: 1kvl (more details), 1.53 Å

PDB Description: X-ray Crystal Structure of AmpC S64G Mutant beta-Lactamase in Complex with Substrate and Product Forms of Cephalothin
PDB Compounds: (B:) Beta-lactamase

SCOP Domain Sequences for d1kvlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvlb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
gvsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d1kvlb_:

Click to download the PDB-style file with coordinates for d1kvlb_.
(The format of our PDB-style files is described here.)

Timeline for d1kvlb_: