SCOPe 2.03: Domain d1kv3f3: 1kv3 F:586-687

Lineage for d1kv3f3 (1kv3 F:586-687)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)
   automatically mapped to Pfam PF00927

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74849] (2 PDB entries)
   GDP-binding protein

8. Domain d1kv3f3: 1kv3 F:586-687 [73049]
   Other proteins in same PDB: d1kv3a1, d1kv3a4, d1kv3b1, d1kv3b4, d1kv3c1, d1kv3c4, d1kv3d1, d1kv3d4, d1kv3e1, d1kv3e4, d1kv3f1, d1kv3f4
   complexed with gdp

Details for d1kv3f3

PDB Entry: 1kv3, 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form

PDB Compounds: (F:) protein-glutamine gamma-glutamyltransferase

SCOPe Domain Sequences for d1kv3f3:

Sequence; same for both SEQRES and ATOM records:

>d1kv3f3 b.1.5.1 (F:586-687) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
npeikirilgepkqkrklvaevslqnplpvalegctftvegaglteeqktveipdpveag
eevkvrmdlvplhmglhklvvnfesdklkavkgfrnviigpa

Timeline for d1kv3f3:

• d1kv3f3 first appeared in SCOP 1.61
  
• d1kv3f3 appears in SCOPe 2.02
  
• d1kv3f3 appears in SCOPe 2.04
  
• d1kv3f3 appears in the current release, SCOPe 2.08