SCOPe 2.06: Domain d1kv3f1: 1kv3 F:15-145

Lineage for d1kv3f1 (1kv3 F:15-145)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)

6. Protein Transglutaminase N-terminal domain [49235] (4 species)
   elaborated with many loop insertions in the common fold

7. Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (4 PDB entries)
   GDP-binding protein

8. Domain d1kv3f1: 1kv3 F:15-145 [73047]
   Other proteins in same PDB: d1kv3a2, d1kv3a3, d1kv3a4, d1kv3b2, d1kv3b3, d1kv3b4, d1kv3c2, d1kv3c3, d1kv3c4, d1kv3d2, d1kv3d3, d1kv3d4, d1kv3e2, d1kv3e3, d1kv3e4, d1kv3f2, d1kv3f3, d1kv3f4
   complexed with gdp

Details for d1kv3f1

PDB Entry: 1kv3, 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form

PDB Compounds: (F:) protein-glutamine gamma-glutamyltransferase

SCOPe Domain Sequences for d1kv3f1:

Sequence, based on SEQRES records:

>d1kv3f1 b.1.18.9 (F:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
etngrdhhtadlcreklvvrrgqpfwltlhfegrnyqasvdsltfsvvtgpapsqeagtk
arfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleastgyqgssfvlgh
fillfnawcpa

Sequence, based on observed residues (ATOM records):

>d1kv3f1 b.1.18.9 (F:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
etngrdhhtadlcreklvvrrgqpfwltlsltfsvvtgpapsqeagtkarfplrdaveeg
dwtatvvdqqdctlslqlttpanapiglyrlsleasghfillfnawcpa

Timeline for d1kv3f1:

• d1kv3f1 first appeared in SCOP 1.61
  
• d1kv3f1 appears in SCOPe 2.05
  
• d1kv3f1 appears in SCOPe 2.07
  
• d1kv3f1 appears in the current release, SCOPe 2.08