Lineage for d1kv3f1 (1kv3 F:15-145)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160881Protein Transglutaminase N-terminal domain [49235] (4 species)
  7. 160902Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (1 PDB entry)
  8. 160908Domain d1kv3f1: 1kv3 F:15-145 [73047]
    Other proteins in same PDB: d1kv3a2, d1kv3a3, d1kv3a4, d1kv3b2, d1kv3b3, d1kv3b4, d1kv3c2, d1kv3c3, d1kv3c4, d1kv3d2, d1kv3d3, d1kv3d4, d1kv3e2, d1kv3e3, d1kv3e4, d1kv3f2, d1kv3f3, d1kv3f4

Details for d1kv3f1

PDB Entry: 1kv3 (more details), 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form

SCOP Domain Sequences for d1kv3f1:

Sequence, based on SEQRES records: (download)

>d1kv3f1 b.1.1.5 (F:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme}
etngrdhhtadlcreklvvrrgqpfwltlhfegrnyqasvdsltfsvvtgpapsqeagtk
arfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleastgyqgssfvlgh
fillfnawcpa

Sequence, based on observed residues (ATOM records): (download)

>d1kv3f1 b.1.1.5 (F:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme}
etngrdhhtadlcreklvvrrgqpfwltlsltfsvvtgpapsqeagtkarfplrdaveeg
dwtatvvdqqdctlslqlttpanapiglyrlsleasghfillfnawcpa

SCOP Domain Coordinates for d1kv3f1:

Click to download the PDB-style file with coordinates for d1kv3f1.
(The format of our PDB-style files is described here.)

Timeline for d1kv3f1: