SCOP 1.75: Domain d1kv3c1: 1kv3 C:15-145

Lineage for d1kv3c1 (1kv3 C:15-145)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (23 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
Protein Transglutaminase N-terminal domain [49235] (4 species)
elaborated with many loop insertions in the common fold
Species Human (Homo sapiens), tissue isozyme [TaxId:9606] [74844] (2 PDB entries)
GDP-binding protein

Domain d1kv3c1: 1kv3 C:15-145 [73035]
Other proteins in same PDB: d1kv3a2, d1kv3a3, d1kv3a4, d1kv3b2, d1kv3b3, d1kv3b4, d1kv3c2, d1kv3c3, d1kv3c4, d1kv3d2, d1kv3d3, d1kv3d4, d1kv3e2, d1kv3e3, d1kv3e4, d1kv3f2, d1kv3f3, d1kv3f4

Details for d1kv3c1

PDB Entry: 1kv3 (more details), 2.8 Å

PDB Description: human tissue transglutaminase in gdp bound form

PDB Compounds: (C:) protein-glutamine gamma-glutamyltransferase

SCOP Domain Sequences for d1kv3c1:

Sequence, based on SEQRES records: (download)

>d1kv3c1 b.1.18.9 (C:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
etngrdhhtadlcreklvvrrgqpfwltlhfegrnyqasvdsltfsvvtgpapsqeagtk
arfplrdaveegdwtatvvdqqdctlslqlttpanapiglyrlsleastgyqgssfvlgh
fillfnawcpa

Sequence, based on observed residues (ATOM records): (download)

>d1kv3c1 b.1.18.9 (C:15-145) Transglutaminase N-terminal domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
etngrdhhtadlcreklvvrrgqpfwltlsltfsvvtgpapsqeagtkarfplrdaveeg
dwtatvvdqqdctlslqlttpanapiglyrlsleasghfillfnawcpa

SCOP Domain Coordinates for d1kv3c1:

Click to download the PDB-style file with coordinates for d1kv3c1.
(The format of our PDB-style files is described here.)

Timeline for d1kv3c1: