Lineage for d1kv2a_ (1kv2 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197199Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 197200Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 197201Family d.144.1.1: Serine/threonin kinases [56113] (18 proteins)
  6. 197323Protein MAP kinase p38 [56129] (2 species)
  7. 197324Species Human (Homo sapiens) [TaxId:9606] [56130] (9 PDB entries)
  8. 197333Domain d1kv2a_: 1kv2 A: [73026]

Details for d1kv2a_

PDB Entry: 1kv2 (more details), 2.8 Å

PDB Description: Human p38 MAP Kinase in Complex with BIRB 796

SCOP Domain Sequences for d1kv2a_:

Sequence, based on SEQRES records: (download)

>d1kv2a_ d.144.1.1 (A:) MAP kinase p38 {Human (Homo sapiens)}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp

Sequence, based on observed residues (ATOM records): (download)

>d1kv2a_ d.144.1.1 (A:) MAP kinase p38 {Human (Homo sapiens)}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlntddhvqfliy
qilrglkyihsadiihrdlkpsnlavnedcelkildftrwyrapeimlnwmhynqtvdiw
svgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqmpk
mnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsf
esrdllidewksltydevisfvppp

SCOP Domain Coordinates for d1kv2a_:

Click to download the PDB-style file with coordinates for d1kv2a_.
(The format of our PDB-style files is described here.)

Timeline for d1kv2a_: