Lineage for d1kuga_ (1kug A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964135Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2964140Protein Snake venom metalloprotease [55520] (7 species)
  7. 2964153Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries)
  8. 2964155Domain d1kuga_: 1kug A: [73008]
    complexed with cd

Details for d1kuga_

PDB Entry: 1kug (more details), 1.37 Å

PDB Description: crystal structure of a taiwan habu venom metalloproteinase complexed with its endogenous inhibitor penw
PDB Compounds: (A:) metalloproteinase

SCOPe Domain Sequences for d1kuga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuga_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]}
qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws
ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek
ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcttcimsavisdkqsklfsdc
skdyyqtfltndnpqcilnap

SCOPe Domain Coordinates for d1kuga_:

Click to download the PDB-style file with coordinates for d1kuga_.
(The format of our PDB-style files is described here.)

Timeline for d1kuga_: