![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.9: Reprolysin-like [55519] (3 proteins) Pfam PF01421 |
![]() | Protein Snake venom metalloprotease [55520] (7 species) |
![]() | Species Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId:103944] [75495] (4 PDB entries) |
![]() | Domain d1kuga_: 1kug A: [73008] complexed with cd |
PDB Entry: 1kug (more details), 1.37 Å
SCOPe Domain Sequences for d1kuga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kuga_ d.92.1.9 (A:) Snake venom metalloprotease {Taiwan habu (Trimeresurus mucrosquamatus), atrolysin E [TaxId: 103944]} qrfpqryielaivvdhgmytkyssnfkkirkrvhqmvsninemcrplniaitlalldvws ekdfitvqadapttaglfgdwrervllkkknhdhaqlltdtnfarntigwayvgrmcdek ysvavvkdhsskvfmvavtmthelghnlgmehddkdkckcttcimsavisdkqsklfsdc skdyyqtfltndnpqcilnap
Timeline for d1kuga_: