Lineage for d1ku3a_ (1ku3 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 278463Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (2 families) (S)
  5. 278473Family a.4.13.2: Sigma4 domain [88665] (4 proteins)
  6. 278474Protein Sigma factor SigA [88668] (1 species)
  7. 278475Species Thermus aquaticus [TaxId:271] [88669] (2 PDB entries)
  8. 278476Domain d1ku3a_: 1ku3 A: [73000]
    sigma4 domain only
    mutant

Details for d1ku3a_

PDB Entry: 1ku3 (more details), 1.8 Å

PDB Description: crystal structure of thermus aquaticus rna polymerase sigma subunit fragment, region 4

SCOP Domain Sequences for d1ku3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku3a_ a.4.13.2 (A:) Sigma factor SigA {Thermus aquaticus}
elekalsklsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklkyhe
s

SCOP Domain Coordinates for d1ku3a_:

Click to download the PDB-style file with coordinates for d1ku3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ku3a_: