Class a: All alpha proteins [46456] (179 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (2 families) |
Family a.4.13.2: Sigma4 domain [88665] (4 proteins) |
Protein Sigma factor SigA [88668] (1 species) |
Species Thermus aquaticus [TaxId:271] [88669] (2 PDB entries) |
Domain d1ku3a_: 1ku3 A: [73000] sigma4 domain only mutant |
PDB Entry: 1ku3 (more details), 1.8 Å
SCOP Domain Sequences for d1ku3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ku3a_ a.4.13.2 (A:) Sigma factor SigA {Thermus aquaticus} elekalsklsereamvlkmrkglidgrehtleevgayfgvtrerirqienkalrklkyhe s
Timeline for d1ku3a_: