Lineage for d1ku2a_ (1ku2 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216884Fold a.112: RNA polymerase sigma subunit [48328] (1 superfamily)
    multihelical; consists of several all-alpha subdomains
  4. 216885Superfamily a.112.1: RNA polymerase sigma subunit [48329] (1 family) (S)
  5. 216886Family a.112.1.1: RNA polymerase sigma subunit [48330] (4 proteins)
  6. 216887Protein Sigma factor SigA fragments [74767] (1 species)
  7. 216888Species Thermus aquaticus [TaxId:271] [74768] (3 PDB entries)
  8. 216892Domain d1ku2a_: 1ku2 A: [72998]

Details for d1ku2a_

PDB Entry: 1ku2 (more details), 2.9 Å

PDB Description: Crystal Structure of Thermus aquaticus RNA Polymerase Sigma Subunit Fragment Containing Regions 1.2 to 3.1

SCOP Domain Sequences for d1ku2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ku2a_ a.112.1.1 (A:) Sigma factor SigA fragments {Thermus aquaticus}
sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
tariqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvs
iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart
iripvhmvetinklsrtarqlqqelgrepsyeeiaeamgpgwdakrveetlkiaqepvsl

SCOP Domain Coordinates for d1ku2a_:

Click to download the PDB-style file with coordinates for d1ku2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ku2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ku2b_