Lineage for d1ktpa_ (1ktp A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 531798Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 531823Protein Phycocyanin alpha subunit [88933] (6 species)
  7. 531860Species Synechococcus vulcanus [TaxId:32053] [88938] (3 PDB entries)
  8. 531861Domain d1ktpa_: 1ktp A: [72990]
    Other proteins in same PDB: d1ktpb_
    complexed with cyc, men

Details for d1ktpa_

PDB Entry: 1ktp (more details), 1.6 Å

PDB Description: Crystal structure of c-phycocyanin of synechococcus vulcanus at 1.6 angstroms

SCOP Domain Sequences for d1ktpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktpa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOP Domain Coordinates for d1ktpa_:

Click to download the PDB-style file with coordinates for d1ktpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ktpa_: