Lineage for d1ktpa_ (1ktp A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 276690Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 276715Protein Phycocyanin alpha subunit [88933] (6 species)
  7. 276752Species Synechococcus vulcanus [TaxId:32053] [88938] (3 PDB entries)
  8. 276753Domain d1ktpa_: 1ktp A: [72990]
    Other proteins in same PDB: d1ktpb_
    complexed with cyc, men

Details for d1ktpa_

PDB Entry: 1ktp (more details), 1.6 Å

PDB Description: Crystal structure of c-phycocyanin of synechococcus vulcanus at 1.6 angstroms

SCOP Domain Sequences for d1ktpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktpa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

SCOP Domain Coordinates for d1ktpa_:

Click to download the PDB-style file with coordinates for d1ktpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ktpa_: