SCOP 1.69: Domain d1ktkf2: 1ktk F:124-240

Lineage for d1ktkf2 (1ktk F:124-240)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (11 PDB entries)

8. Domain d1ktkf2: 1ktk F:124-240 [72987]
   Other proteins in same PDB: d1ktka1, d1ktka2, d1ktkb1, d1ktkb2, d1ktkc1, d1ktkc2, d1ktkd1, d1ktkd2, d1ktke1, d1ktkf1

Details for d1ktkf2

PDB Entry: 1ktk, 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktkf2:

Sequence, based on SEQRES records:

>d1ktkf2 b.1.1.2 (F:124-240) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqp
alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae

Sequence, based on observed residues (ATOM records):

>d1ktkf2 b.1.1.2 (F:124-240) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
ppevavfepvclatgfndsryalssrlqnprnhfrvqfyvtqivsae

Timeline for d1ktkf2:

• d1ktkf2 first appeared in SCOP 1.61
  
• d1ktkf2 appears in SCOP 1.67
  
• d1ktkf2 appears in SCOP 1.71
  
• d1ktkf2 appears in the current release, SCOPe 2.08