SCOPe 2.04: Domain d1ktke2: 1ktk E:119-246

Lineage for d1ktke2 (1ktk E:119-246)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)

8. Domain d1ktke2: 1ktk E:119-246 [72985]
   Other proteins in same PDB: d1ktka1, d1ktka2, d1ktkb1, d1ktkb2, d1ktkc1, d1ktkc2, d1ktkd1, d1ktkd2, d1ktke1, d1ktkf1

Details for d1ktke2

PDB Entry: 1ktk, 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

PDB Compounds: (E:) T-cell receptor beta chain

SCOPe Domain Sequences for d1ktke2:

Sequence; same for both SEQRES and ATOM records:

>d1ktke2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Timeline for d1ktke2:

• d1ktke2 first appeared in SCOP 1.61
  
• d1ktke2 appears in SCOPe 2.03
  
• d1ktke2 appears in SCOPe 2.05
  
• d1ktke2 appears in the current release, SCOPe 2.08