Lineage for d1ktke2 (1ktk E:119-246)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550341Protein T-cell antigen receptor [49125] (6 species)
  7. 550352Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (11 PDB entries)
  8. 550362Domain d1ktke2: 1ktk E:119-246 [72985]
    Other proteins in same PDB: d1ktka1, d1ktka2, d1ktkb1, d1ktkb2, d1ktkc1, d1ktkc2, d1ktkd1, d1ktkd2, d1ktke1, d1ktkf1

Details for d1ktke2

PDB Entry: 1ktk (more details), 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktke2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
dlknfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOP Domain Coordinates for d1ktke2:

Click to download the PDB-style file with coordinates for d1ktke2.
(The format of our PDB-style files is described here.)

Timeline for d1ktke2: