Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries) |
Domain d1ktke2: 1ktk E:119-246 [72985] Other proteins in same PDB: d1ktka1, d1ktka2, d1ktkb1, d1ktkb2, d1ktkc1, d1ktkc2, d1ktkd1, d1ktkd2, d1ktke1, d1ktkf1 |
PDB Entry: 1ktk (more details), 3 Å
SCOPe Domain Sequences for d1ktke2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktke2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgrad
Timeline for d1ktke2: