SCOP 1.61: Domain d1ktke1: 1ktk E:1-118

Lineage for d1ktke1 (1ktk E:1-118)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (8 PDB entries)

8. Domain d1ktke1: 1ktk E:1-118 [72984]
   Other proteins in same PDB: d1ktka1, d1ktka2, d1ktkb1, d1ktkb2, d1ktkc1, d1ktkc2, d1ktkd1, d1ktkd2, d1ktke2, d1ktkf2

Details for d1ktke1

PDB Entry: 1ktk, 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktke1:

Sequence; same for both SEQRES and ATOM records:

>d1ktke1 b.1.1.1 (E:1-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gavvsqhpsrviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsaegskatyeq
gvekdkflinhasltlstltvtsahpedssfyicsalagsgsstdtqyfgpgtrltvle

Timeline for d1ktke1:

• d1ktke1 is new in SCOP 1.61
  
• d1ktke1 appears in SCOP 1.63
  
• d1ktke1 appears in the current release, SCOPe 2.08