Lineage for d1ktkd1 (1ktk D:3-95)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462850Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 463253Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 463367Protein Streptococcal superantigen Spe-C [50232] (1 species)
  7. 463368Species Streptococcus pyogenes [TaxId:1314] [50233] (3 PDB entries)
  8. 463374Domain d1ktkd1: 1ktk D:3-95 [72982]
    Other proteins in same PDB: d1ktka2, d1ktkb2, d1ktkc2, d1ktkd2, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2

Details for d1ktkd1

PDB Entry: 1ktk (more details), 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktkd1 b.40.2.2 (D:3-95) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn

SCOP Domain Coordinates for d1ktkd1:

Click to download the PDB-style file with coordinates for d1ktkd1.
(The format of our PDB-style files is described here.)

Timeline for d1ktkd1: