Lineage for d1ktkc2 (1ktk C:96-208)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403556Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1403557Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1403702Protein Streptococcal superantigen Spe-C [54348] (1 species)
  7. 1403703Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)
  8. 1403708Domain d1ktkc2: 1ktk C:96-208 [72981]
    Other proteins in same PDB: d1ktka1, d1ktkb1, d1ktkc1, d1ktkd1, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2

Details for d1ktkc2

PDB Entry: 1ktk (more details), 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)
PDB Compounds: (C:) Exotoxin type C

SCOPe Domain Sequences for d1ktkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktkc2 d.15.6.1 (C:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

SCOPe Domain Coordinates for d1ktkc2:

Click to download the PDB-style file with coordinates for d1ktkc2.
(The format of our PDB-style files is described here.)

Timeline for d1ktkc2: