SCOP 1.61: Domain d1ktkc1: 1ktk C:1-95

Lineage for d1ktkc1 (1ktk C:1-95)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Streptococcal superantigen Spe-C [50232] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50233] (3 PDB entries)

8. Domain d1ktkc1: 1ktk C:1-95 [72980]
   Other proteins in same PDB: d1ktka2, d1ktkb2, d1ktkc2, d1ktkd2, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2

Details for d1ktkc1

PDB Entry: 1ktk, 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktkc1:

Sequence; same for both SEQRES and ATOM records:

>d1ktkc1 b.40.2.2 (C:1-95) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
dskkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeas
qkfkrddhvdvfglfyilnshtgeyiyggitpaqn

Timeline for d1ktkc1:

• d1ktkc1 is new in SCOP 1.61
  
• d1ktkc1 appears in SCOP 1.63
  
• d1ktkc1 appears in the current release, SCOPe 2.08