SCOPe 2.04: Domain d1ktka2: 1ktk A:96-208

Lineage for d1ktka2 (1ktk A:96-208)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Streptococcal superantigen Spe-C [54348] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)

8. Domain d1ktka2: 1ktk A:96-208 [72977]
   Other proteins in same PDB: d1ktka1, d1ktkb1, d1ktkc1, d1ktkd1, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2

Details for d1ktka2

PDB Entry: 1ktk, 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

PDB Compounds: (A:) Exotoxin type C

SCOPe Domain Sequences for d1ktka2:

Sequence, based on SEQRES records:

>d1ktka2 d.15.6.1 (A:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

Sequence, based on observed residues (ATOM records):

>d1ktka2 d.15.6.1 (A:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
nkvnhkllgnlfisesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvsg
rieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

Timeline for d1ktka2:

• d1ktka2 first appeared in SCOP 1.61
  
• d1ktka2 appears in SCOPe 2.03
  
• d1ktka2 appears in SCOPe 2.05
  
• d1ktka2 appears in the current release, SCOPe 2.08