Lineage for d1ktka2 (1ktk A:96-208)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499977Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 499978Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 500092Protein Streptococcal superantigen Spe-C [54348] (1 species)
  7. 500093Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)
  8. 500096Domain d1ktka2: 1ktk A:96-208 [72977]
    Other proteins in same PDB: d1ktka1, d1ktkb1, d1ktkc1, d1ktkd1, d1ktke1, d1ktke2, d1ktkf1, d1ktkf2

Details for d1ktka2

PDB Entry: 1ktk (more details), 3 Å

PDB Description: Complex of Streptococcal pyrogenic enterotoxin C (SpeC) with a human T cell receptor beta chain (Vbeta2.1)

SCOP Domain Sequences for d1ktka2:

Sequence, based on SEQRES records: (download)

>d1ktka2 d.15.6.1 (A:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

Sequence, based on observed residues (ATOM records): (download)

>d1ktka2 d.15.6.1 (A:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
nkvnhkllgnlfisesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvsg
rieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

SCOP Domain Coordinates for d1ktka2:

Click to download the PDB-style file with coordinates for d1ktka2.
(The format of our PDB-style files is described here.)

Timeline for d1ktka2: