Lineage for d1ktjb_ (1ktj B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765571Family b.1.18.7: ML domain [81287] (3 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
    automatically mapped to Pfam PF02221
  6. 2765578Protein Major mite allergen [49256] (2 species)
    contains additional N-terminal strand
  7. 2765589Species House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId:6956] [49258] (2 PDB entries)
  8. 2765591Domain d1ktjb_: 1ktj B: [72975]

Details for d1ktjb_

PDB Entry: 1ktj (more details), 2.15 Å

PDB Description: x-ray structure of der p 2, the major house dust mite allergen
PDB Compounds: (B:) allergen der p 2

SCOPe Domain Sequences for d1ktjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktjb_ b.1.18.7 (B:) Major mite allergen {House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId: 6956]}
sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
iathakird

SCOPe Domain Coordinates for d1ktjb_:

Click to download the PDB-style file with coordinates for d1ktjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ktjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ktja_