| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
| Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (7 PDB entries) probably orthologous to the human HLA-DR group |
| Domain d1ktdc1: 1ktd C:82-182 [72968] Other proteins in same PDB: d1ktda2, d1ktdb1, d1ktdb2, d1ktdc2, d1ktdd1, d1ktdd2 complexed with nag, so4; mutant |
PDB Entry: 1ktd (more details), 2.4 Å
SCOP Domain Sequences for d1ktdc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktdc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee
Timeline for d1ktdc1: