Lineage for d1ktdb2 (1ktd B:1-120)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326974Protein Class II MHC beta chain, N-terminal domain [88819] (13 species)
  7. 327036Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (7 PDB entries)
  8. 327043Domain d1ktdb2: 1ktd B:1-120 [72967]
    Other proteins in same PDB: d1ktda1, d1ktda2, d1ktdb1, d1ktdc1, d1ktdc2, d1ktdd1

Details for d1ktdb2

PDB Entry: 1ktd (more details), 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide

SCOP Domain Sequences for d1ktdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktdb2 d.19.1.1 (B:1-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK}
aadliaylkqasakggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfyn
leenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvpr

SCOP Domain Coordinates for d1ktdb2:

Click to download the PDB-style file with coordinates for d1ktdb2.
(The format of our PDB-style files is described here.)

Timeline for d1ktdb2: