Lineage for d1ktda2 (1ktd A:1-81)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409588Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 409658Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)
  8. 409669Domain d1ktda2: 1ktd A:1-81 [72965]
    Other proteins in same PDB: d1ktda1, d1ktdb1, d1ktdb2, d1ktdc1, d1ktdd1, d1ktdd2

Details for d1ktda2

PDB Entry: 1ktd (more details), 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide

SCOP Domain Sequences for d1ktda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktda2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOP Domain Coordinates for d1ktda2:

Click to download the PDB-style file with coordinates for d1ktda2.
(The format of our PDB-style files is described here.)

Timeline for d1ktda2: