Lineage for d1ktda2 (1ktd A:1-81)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255405Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 255507Species Mouse (Mus musculus), I-EK [TaxId:10090] [54465] (7 PDB entries)
  8. 255520Domain d1ktda2: 1ktd A:1-81 [72965]
    Other proteins in same PDB: d1ktda1, d1ktdb1, d1ktdc1, d1ktdd1

Details for d1ktda2

PDB Entry: 1ktd (more details), 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide
PDB Compounds: (A:)

SCOP Domain Sequences for d1ktda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktda2 d.19.1.1 (A:1-81) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOP Domain Coordinates for d1ktda2:

Click to download the PDB-style file with coordinates for d1ktda2.
(The format of our PDB-style files is described here.)

Timeline for d1ktda2: