SCOP 1.65: Domain d1ktda1: 1ktd A:82-182

Lineage for d1ktda1 (1ktd A:82-182)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (7 PDB entries)
probably orthologous to the human HLA-DR group
Domain d1ktda1: 1ktd A:82-182 [72964]
Other proteins in same PDB: d1ktda2, d1ktdb1, d1ktdb2, d1ktdc2, d1ktdd1, d1ktdd2

Details for d1ktda1

PDB Entry: 1ktd (more details), 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide

SCOP Domain Sequences for d1ktda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktda1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee

SCOP Domain Coordinates for d1ktda1:

Click to download the PDB-style file with coordinates for d1ktda1.
(The format of our PDB-style files is described here.)

Timeline for d1ktda1: