Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Melibiase [75064] (4 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [75065] (2 PDB entries) alpha-N-acetylgalactosaminidase |
Domain d1ktca2: 1ktc A:1-293 [72963] Other proteins in same PDB: d1ktca1 complexed with acy, gol, nag, nga, so4 |
PDB Entry: 1ktc (more details), 2.4 Å
SCOPe Domain Sequences for d1ktca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktca2 c.1.8.1 (A:1-293) Melibiase {Chicken (Gallus gallus) [TaxId: 9031]} lenglartppmgwlawerfrcnvncredprqcisemlfmemadriaedgwrelgykyini ddcwaakqrdaegrlvpdperfprgikaladyvharglklgiygdlgrltcggypgttld rveqdaqtfaewgvdmlkldgcyssgkeqaqgypqmaralnatgrpivyscswpayqggl ppkvnytllgeicnlwrnyddiqdswdsvlsivdwfftnqdvlqpfagpghwndpdmlii gnfglsyeqsrsqmalwtimaapllmstdlrtispsakkilqnrlmiqinqdp
Timeline for d1ktca2: