SCOPe 2.02: Domain d1kt2c2: 1kt2 C:1-81

Lineage for d1kt2c2 (1kt2 C:1-81)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)

8. Domain d1kt2c2: 1kt2 C:1-81 [72956]
   Other proteins in same PDB: d1kt2a1, d1kt2b1, d1kt2b2, d1kt2c1, d1kt2d1, d1kt2d2
   complexed with nag

Details for d1kt2c2

PDB Entry: 1kt2, 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide

PDB Compounds: (C:) H-2 class II histocompatibility antigen, E-D alpha chain

SCOPe Domain Sequences for d1kt2c2:

Sequence; same for both SEQRES and ATOM records:

>d1kt2c2 d.19.1.1 (C:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

Timeline for d1kt2c2:

• d1kt2c2 first appeared in SCOP 1.61
  
• d1kt2c2 appears in SCOPe 2.01
  
• d1kt2c2 appears in SCOPe 2.03
  
• d1kt2c2 appears in the current release, SCOPe 2.08