SCOPe 2.01: Domain d1kt2c1: 1kt2 C:82-182

Lineage for d1kt2c1 (1kt2 C:82-182)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1kt2c1: 1kt2 C:82-182 [72955]
   Other proteins in same PDB: d1kt2a2, d1kt2b1, d1kt2b2, d1kt2c2, d1kt2d1, d1kt2d2
   complexed with nag

Details for d1kt2c1

PDB Entry: 1kt2, 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide

PDB Compounds: (C:) H-2 class II histocompatibility antigen, E-D alpha chain

SCOPe Domain Sequences for d1kt2c1:

Sequence; same for both SEQRES and ATOM records:

>d1kt2c1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

Timeline for d1kt2c1:

• d1kt2c1 first appeared in SCOP 1.61
  
• d1kt2c1 appears in SCOP 1.75
  
• d1kt2c1 appears in SCOPe 2.02
  
• d1kt2c1 appears in the current release, SCOPe 2.08