Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries) probably orthologous to the human HLA-DR group |
Domain d1kt2c1: 1kt2 C:82-182 [72955] Other proteins in same PDB: d1kt2a2, d1kt2b1, d1kt2b2, d1kt2c2, d1kt2d1, d1kt2d2 complexed with nag |
PDB Entry: 1kt2 (more details), 2.8 Å
SCOP Domain Sequences for d1kt2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kt2c1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
Timeline for d1kt2c1: