Lineage for d1kt2c1 (1kt2 C:82-182)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220836Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (7 PDB entries)
  8. 220867Domain d1kt2c1: 1kt2 C:82-182 [72955]
    Other proteins in same PDB: d1kt2a2, d1kt2b2, d1kt2c2, d1kt2d2

Details for d1kt2c1

PDB Entry: 1kt2 (more details), 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
PDB Compounds: (C:)

SCOP Domain Sequences for d1kt2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kt2c1 b.1.1.2 (C:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

SCOP Domain Coordinates for d1kt2c1:

Click to download the PDB-style file with coordinates for d1kt2c1.
(The format of our PDB-style files is described here.)

Timeline for d1kt2c1: