Lineage for d1kt2b1 (1kt2 B:121-215)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288980Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 289035Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (7 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 289050Domain d1kt2b1: 1kt2 B:121-215 [72953]
    Other proteins in same PDB: d1kt2a1, d1kt2a2, d1kt2b2, d1kt2c1, d1kt2c2, d1kt2d2

Details for d1kt2b1

PDB Entry: 1kt2 (more details), 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide

SCOP Domain Sequences for d1kt2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kt2b1 b.1.1.2 (B:121-215) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group}
rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
tfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOP Domain Coordinates for d1kt2b1:

Click to download the PDB-style file with coordinates for d1kt2b1.
(The format of our PDB-style files is described here.)

Timeline for d1kt2b1: