Lineage for d1kt2a2 (1kt2 A:1-81)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326693Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 326694Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 326695Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 326895Protein Class II MHC alpha chain, N-terminal domain [88806] (13 species)
  7. 326957Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (7 PDB entries)
  8. 326972Domain d1kt2a2: 1kt2 A:1-81 [72952]
    Other proteins in same PDB: d1kt2a1, d1kt2b1, d1kt2b2, d1kt2c1, d1kt2d1, d1kt2d2

Details for d1kt2a2

PDB Entry: 1kt2 (more details), 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide

SCOP Domain Sequences for d1kt2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kt2a2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOP Domain Coordinates for d1kt2a2:

Click to download the PDB-style file with coordinates for d1kt2a2.
(The format of our PDB-style files is described here.)

Timeline for d1kt2a2: