![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
![]() | Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (7 PDB entries) probably orthologous to the human HLA-DR group |
![]() | Domain d1kt2a1: 1kt2 A:82-182 [72951] Other proteins in same PDB: d1kt2a2, d1kt2b1, d1kt2b2, d1kt2c2, d1kt2d1, d1kt2d2 |
PDB Entry: 1kt2 (more details), 2.8 Å
SCOP Domain Sequences for d1kt2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kt2a1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group} danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee
Timeline for d1kt2a1: