Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein) automatically mapped to Pfam PF01479 |
Protein Pseudouridine synthase RsuA N-terminal domain [75469] (2 species) |
Species Escherichia coli [TaxId:562] [75470] (3 PDB entries) |
Domain d1ksva3: 1ksv A:1-59 [72939] Other proteins in same PDB: d1ksva4 complexed with u |
PDB Entry: 1ksv (more details), 2.65 Å
SCOPe Domain Sequences for d1ksva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksva3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli [TaxId: 562]} mrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqqhg
Timeline for d1ksva3: