Lineage for d1ksva3 (1ksv A:1-59)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 258422Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 258423Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (4 families) (S)
    common motif in otherwise different folds
  5. 258457Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein)
  6. 258458Protein Pseudouridine synthase RsuA N-terminal domain [75469] (1 species)
  7. 258459Species Escherichia coli [TaxId:562] [75470] (3 PDB entries)
  8. 258462Domain d1ksva3: 1ksv A:1-59 [72939]
    Other proteins in same PDB: d1ksva1, d1ksva2
    complexed with mse, u

Details for d1ksva3

PDB Entry: 1ksv (more details), 2.65 Å

PDB Description: structure of rsua

SCOP Domain Sequences for d1ksva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksva3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli}
mrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqqhg

SCOP Domain Coordinates for d1ksva3:

Click to download the PDB-style file with coordinates for d1ksva3.
(The format of our PDB-style files is described here.)

Timeline for d1ksva3: