Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) |
Superfamily d.58.35: Pseudouridine synthase [55120] (3 families) |
Family d.58.35.3: Ribosomal small subunit pseudouridine 516 synthase RsuA [75459] (1 protein) |
Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (1 species) |
Species Escherichia coli [TaxId:562] [75461] (3 PDB entries) |
Domain d1ksva2: 1ksv A:125-231 [72938] Other proteins in same PDB: d1ksva3 |
PDB Entry: 1ksv (more details), 2.65 Å
SCOP Domain Sequences for d1ksva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksva2 d.58.35.3 (A:125-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli} rhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrltisegryh qvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv
Timeline for d1ksva2: