SCOP 1.65: Domain d1ksva1: 1ksv A:60-124

Lineage for d1ksva1 (1ksv A:60-124)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.35: Pseudouridine synthase [55120] (3 families)
   duplication: contains two subdomains of this fold

5. Family d.58.35.3: Ribosomal small subunit pseudouridine 516 synthase RsuA [75459] (1 protein)
   contains N-terminal alpha-L RNA-binding motif

6. Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (1 species)

7. Species Escherichia coli [TaxId:562] [75461] (3 PDB entries)

8. Domain d1ksva1: 1ksv A:60-124 [72937]
   Other proteins in same PDB: d1ksva3

Details for d1ksva1

PDB Entry: 1ksv, 2.65 Å

PDB Description: structure of rsua

SCOP Domain Sequences for d1ksva1:

Sequence; same for both SEQRES and ATOM records:

>d1ksva1 d.58.35.3 (A:60-124) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli}
pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh
ritsp

Timeline for d1ksva1:

• d1ksva1 first appeared in SCOP 1.61
  
• d1ksva1 appears in SCOP 1.63
  
• d1ksva1 does not appear in SCOP 1.67