Lineage for d1kska3 (1ksk A:1-59)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605384Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 605385Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 605423Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein)
  6. 605424Protein Pseudouridine synthase RsuA N-terminal domain [75469] (2 species)
  7. 605425Species Escherichia coli [TaxId:562] [75470] (3 PDB entries)
  8. 605426Domain d1kska3: 1ksk A:1-59 [72920]
    Other proteins in same PDB: d1kska4
    complexed with mse, ura

Details for d1kska3

PDB Entry: 1ksk (more details), 2 Å

PDB Description: structure of rsua

SCOP Domain Sequences for d1kska3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kska3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli}
mrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqqhg

SCOP Domain Coordinates for d1kska3:

Click to download the PDB-style file with coordinates for d1kska3.
(The format of our PDB-style files is described here.)

Timeline for d1kska3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kska4