Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.35: Pseudouridine synthase [55120] (3 families) duplication: contains two subdomains of this fold |
Family d.58.35.3: Ribosomal small subunit pseudouridine 516 synthase RsuA [75459] (1 protein) contains N-terminal alpha-L RNA-binding motif |
Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (1 species) |
Species Escherichia coli [TaxId:562] [75461] (3 PDB entries) |
Domain d1kska2: 1ksk A:125-231 [72919] Other proteins in same PDB: d1kska3 complexed with mse, ura |
PDB Entry: 1ksk (more details), 2 Å
SCOP Domain Sequences for d1kska2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kska2 d.58.35.3 (A:125-231) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli} rhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrltisegryh qvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv
Timeline for d1kska2: