Lineage for d1kska1 (1ksk A:60-124)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329948Superfamily d.58.35: Pseudouridine synthase [55120] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 329961Family d.58.35.3: Ribosomal small subunit pseudouridine 516 synthase RsuA [75459] (1 protein)
    contains N-terminal alpha-L RNA-binding motif
  6. 329962Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (1 species)
  7. 329963Species Escherichia coli [TaxId:562] [75461] (3 PDB entries)
  8. 329964Domain d1kska1: 1ksk A:60-124 [72918]
    Other proteins in same PDB: d1kska3

Details for d1kska1

PDB Entry: 1ksk (more details), 2 Å

PDB Description: structure of rsua

SCOP Domain Sequences for d1kska1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kska1 d.58.35.3 (A:60-124) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli}
pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh
ritsp

SCOP Domain Coordinates for d1kska1:

Click to download the PDB-style file with coordinates for d1kska1.
(The format of our PDB-style files is described here.)

Timeline for d1kska1: