Lineage for d1kska1 (1ksk A:60-124)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 193006Superfamily d.58.35: Pseudouridine synthase [55120] (3 families) (S)
  5. 193019Family d.58.35.3: Ribosomal small subunit pseudouridine 516 synthase RsuA [75459] (1 protein)
  6. 193020Protein Ribosomal small subunit pseudouridine 516 synthase RsuA [75460] (1 species)
  7. 193021Species Escherichia coli [TaxId:562] [75461] (3 PDB entries)
  8. 193022Domain d1kska1: 1ksk A:60-124 [72918]
    Other proteins in same PDB: d1kska3

Details for d1kska1

PDB Entry: 1ksk (more details), 2 Å

PDB Description: structure of rsua

SCOP Domain Sequences for d1kska1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kska1 d.58.35.3 (A:60-124) Ribosomal small subunit pseudouridine 516 synthase RsuA {Escherichia coli}
pryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqwsh
ritsp

SCOP Domain Coordinates for d1kska1:

Click to download the PDB-style file with coordinates for d1kska1.
(The format of our PDB-style files is described here.)

Timeline for d1kska1: