Lineage for d1ksjb_ (1ksj B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552337Family b.1.18.8: RhoGDI-like [81288] (2 proteins)
  6. 552338Protein GMP-PDE delta [74846] (1 species)
  7. 552339Species Human (Homo sapiens) [TaxId:9606] [74847] (3 PDB entries)
  8. 552342Domain d1ksjb_: 1ksj B: [72917]
    Other proteins in same PDB: d1ksja_
    complexed with ARL2
    complexed with bme, cme, gdp, gtp, mg, mse, po4; mutant

Details for d1ksjb_

PDB Entry: 1ksj (more details), 2.6 Å

PDB Description: complex of arl2 and pde delta, crystal form 2 (semet)

SCOP Domain Sequences for d1ksjb_:

Sequence, based on SEQRES records: (download)

>d1ksjb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens)}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records): (download)

>d1ksjb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens)}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqsliepasvltgnvii
etkffdddllvstsrvrlfyv

SCOP Domain Coordinates for d1ksjb_:

Click to download the PDB-style file with coordinates for d1ksjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ksjb_: