| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (16 species) |
| Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (5 PDB entries) |
| Domain d1ksja_: 1ksj A: [72916] Other proteins in same PDB: d1ksjb_ complexed with GMP-PDE delta complexed with bme, gdp, gtp, mg, po4 |
PDB Entry: 1ksj (more details), 2.6 Å
SCOPe Domain Sequences for d1ksja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksja_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
relrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvggqkslr
sywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgals
cnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr
Timeline for d1ksja_: